Military56
Column quantity
Clear all
Tropical power unit Qty 1
Tropical power unit Qty 1

Tropical power unit Qty 1

£100.00 GBP £100.00 GBP
Airmacelectricalequipmentindustrialionisationkittesttestervintage

This product can only be purchased with a selling plan

You can't add more Tropical power unit Qty 1 to cart
Grey aluminium box Qty 1
Grey aluminium box Qty 1

Grey aluminium box Qty 1

£240.00 GBP £240.00 GBP
1950s1960s1970s1980s1990sboxboxescrateindustrialvintage

This product can only be purchased with a selling plan

You can't add more Grey aluminium box Qty 1 to cart
Green lead lined boxes. Qty 20.
Green lead lined boxes. Qty 20.

Green lead lined boxes. Qty 20.

£140.00 GBP £140.00 GBP
boxboxescrateindustrialleadmilitaryvintage

This product can only be purchased with a selling plan

You can't add more Green lead lined boxes. Qty 20. to cart
Electrical control panel Qty 1
Electrical control panel Qty 1

Electrical control panel Qty 1

£180.00 GBP £180.00 GBP
1920s1930s1940s1950sdecadeelectricalindustrialresistanceswitchesswitchgearvintage

This product can only be purchased with a selling plan

You can't add more Electrical control panel Qty 1 to cart
Survey boxes Qty 3

Survey boxes Qty 3

£60.00 GBP £60.00 GBP
1950s1960s1970s1980sboxboxesgarageindustrialmeternuclearsurveyvintage

This product can only be purchased with a selling plan

You can't add more Survey boxes Qty 3 to cart
Military storage crate Qty 2
Military storage crate Qty 2

Military storage crate Qty 2

£480.00 GBP £480.00 GBP
boxcontainercrateindustrialmilitarystoragevintage

This product can only be purchased with a selling plan

You can't add more Military storage crate Qty 2 to cart
Military storage crate Qty 7
Military storage crate Qty 7

Military storage crate Qty 7

£200.00 GBP £200.00 GBP
boxcontainercrateindustrialmilitarystoragevintage

This product can only be purchased with a selling plan

You can't add more Military storage crate Qty 7 to cart
Military crate round Qty 1
Military crate round Qty 1

Military crate round Qty 1

£690.00 GBP £690.00 GBP
1970'sboxcontainercrateindustrialmilitaryroundstoragevintage

This product can only be purchased with a selling plan

You can't add more Military crate round Qty 1 to cart
Military cooking station Qty 4
Military cooking station Qty 4

Military cooking station Qty 4

£290.00 GBP £290.00 GBP
1970's1980's1990's2000's2010burnercookercookinggasindustrialmilitarystationtablevintage

This product can only be purchased with a selling plan

You can't add more Military cooking station Qty 4 to cart
Synchro tester Qty 1

Synchro tester Qty 1

£95.00 GBP £95.00 GBP
1950's1960's1970's1980'selectricalindustrialmilitarytest kittestervintage

This product can only be purchased with a selling plan

You can't add more Synchro tester Qty 1 to cart
Sold out
Volt meter military Qty 8

Volt meter military Qty 8

£10.00 GBP £10.00 GBP
electricalindustrialmetermilitarytesttestervintagevolt

This product can only be purchased with a selling plan

You can't add more Volt meter military Qty 8 to cart
Military weapon cases Qty 31
Military weapon cases Qty 31

Military weapon cases Qty 31

£300.00 GBP £300.00 GBP
1940's1950'sammoboxescasescratesindustrialmilitaryvintageweapons

This product can only be purchased with a selling plan

You can't add more Military weapon cases Qty 31 to cart
Round fuel cans Qty 14
Round fuel cans Qty 14

Round fuel cans Qty 14

£45.00 GBP £45.00 GBP
cansdrumsfuelgarageindustrialmilitaryoilvintage

This product can only be purchased with a selling plan

You can't add more Round fuel cans Qty 14 to cart
Military volted regulator Qty 1

Military volted regulator Qty 1

£70.00 GBP £70.00 GBP
1950's1960'sgeneratorindustrialmilitarypanelregulatorvehicle partvintagevolted

This product can only be purchased with a selling plan

You can't add more Military volted regulator Qty 1 to cart
US military steel pallets Qty 10
US military steel pallets Qty 10

US military steel pallets Qty 10

£140.00 GBP £140.00 GBP
1940s1950s1960s1970sindustrialmetalmilitarypalletssteelUSvintage

This product can only be purchased with a selling plan

You can't add more US military steel pallets Qty 10 to cart
Mesh locker military cabinets Qty 3
Mesh locker military cabinets Qty 3

Mesh locker military cabinets Qty 3

£490.00 GBP £490.00 GBP
cabinetindustriallockersmeshmilitaryvintage

This product can only be purchased with a selling plan

You can't add more Mesh locker military cabinets Qty 3 to cart
Military crate Qty 7
Military crate Qty 7

Military crate Qty 7

£600.00 GBP £600.00 GBP
boxcrateindustrialmilitarymissilevintageweaponweapons

This product can only be purchased with a selling plan

You can't add more Military crate Qty 7 to cart
Military crate Qty 2
Military crate Qty 2

Military crate Qty 2

£800.00 GBP £800.00 GBP
1940s1950s1960s1970s1980s1990s2000s2010s2020sboxcrateindustrialmilitarymissilevintageweaponweapons

This product can only be purchased with a selling plan

You can't add more Military crate Qty 2 to cart
Plastic storage crates Qty 3
Plastic storage crates Qty 3

Plastic storage crates Qty 3

£380.00 GBP £380.00 GBP
1970s1980s1990s2000s2010s2020scontainercrateindustrialmilitaryplasticstoragevintage

This product can only be purchased with a selling plan

You can't add more Plastic storage crates Qty 3 to cart
Plastic storage containers Qty 2
Plastic storage containers Qty 2

Plastic storage containers Qty 2

£380.00 GBP £380.00 GBP
1970s1980s1990s2000s2010s2020scontainercrateindustrialmilitaryplasticstoragevintage

This product can only be purchased with a selling plan

You can't add more Plastic storage containers Qty 2 to cart
Plastic black storage containers Qty 2
Plastic black storage containers Qty 2

Plastic black storage containers Qty 2

£290.00 GBP £290.00 GBP
1970s1980s1990s2000s2010s2020scontainercrateindustrialmilitaryplasticstoragevintage

This product can only be purchased with a selling plan

You can't add more Plastic black storage containers Qty 2 to cart
Military signal box Qty 10
Military signal box Qty 10

Military signal box Qty 10

£120.00 GBP £120.00 GBP
1970s1980s1990s2000s2010sboxboxescontainerscratecratesindustrialmilitaryvintage

This product can only be purchased with a selling plan

You can't add more Military signal box Qty 10 to cart
MOD radio battery charger Qty 1
MOD radio battery charger Qty 1

MOD radio battery charger Qty 1

£80.00 GBP £80.00 GBP
1950s1960s1970selectricalindustrialmilitaryMODRedifonvintage

This product can only be purchased with a selling plan

You can't add more MOD radio battery charger Qty 1 to cart
MOD fuel flow tester Qty 1
MOD fuel flow tester Qty 1

MOD fuel flow tester Qty 1

£300.00 GBP £300.00 GBP
1950s1960saeronauticalelectricalflowfuelindustrialmilitaryMODtestervintage

This product can only be purchased with a selling plan

You can't add more MOD fuel flow tester Qty 1 to cart
MOD multimeter Qty 1
MOD multimeter Qty 1

MOD multimeter Qty 1

£120.00 GBP £120.00 GBP
1950s1960saeronauticalaviationelectricalindustrialmilitaryMODvintage

This product can only be purchased with a selling plan

You can't add more MOD multimeter Qty 1 to cart
Air force test set Qty 2
Air force test set Qty 2

Air force test set Qty 2

£290.00 GBP £290.00 GBP
1950s1960sair forceelectricalindustrialmilitarytestvintage

This product can only be purchased with a selling plan

You can't add more Air force test set Qty 2 to cart
MOD test set kit Qty 1
MOD test set kit Qty 1

MOD test set kit Qty 1

£1,200.00 GBP £1,200.00 GBP
1950s1960saeronauticalelectricalindustrialkitMODtestvintage

This product can only be purchased with a selling plan

You can't add more MOD test set kit Qty 1 to cart
MOD testing set kit Qty 2
MOD testing set kit Qty 2

MOD testing set kit Qty 2

£290.00 GBP £290.00 GBP
1950s1960selectricalindustrialkitmilitaryradiotesttestingvintage

This product can only be purchased with a selling plan

You can't add more MOD testing set kit Qty 2 to cart
Radio test set Qty 1
Radio test set Qty 1

Radio test set Qty 1

£290.00 GBP £290.00 GBP
1950s1960sindustrialkitMODtesttestingvintage

This product can only be purchased with a selling plan

You can't add more Radio test set Qty 1 to cart
MOD decade capacitance box Qty 2
MOD decade capacitance box Qty 2

MOD decade capacitance box Qty 2

£140.00 GBP £140.00 GBP
boxcapacitancedecadeelectricalMODvintage

This product can only be purchased with a selling plan

You can't add more MOD decade capacitance box Qty 2 to cart
MOD synchro test set Qty 1
MOD synchro test set Qty 1

MOD synchro test set Qty 1

£150.00 GBP £150.00 GBP
electricalElliotMODsynchrotestvintage

This product can only be purchased with a selling plan

You can't add more MOD synchro test set Qty 1 to cart
MOD general purpose test kit Qty 1
MOD general purpose test kit Qty 1

MOD general purpose test kit Qty 1

£110.00 GBP £110.00 GBP
electricalgeneralkitmilitaryMODpurposetestvintage

This product can only be purchased with a selling plan

You can't add more MOD general purpose test kit Qty 1 to cart
Indicator phase sequence Qty 1
Indicator phase sequence Qty 1

Indicator phase sequence Qty 1

£150.00 GBP £150.00 GBP
electricalindicatorMODphasescientificsequencevintage

This product can only be purchased with a selling plan

You can't add more Indicator phase sequence Qty 1 to cart
MOD resistance tester Qty 2
MOD resistance tester Qty 2

MOD resistance tester Qty 2

£130.00 GBP £130.00 GBP
electricalmilitaryMODresistancescientifictestervintage

This product can only be purchased with a selling plan

You can't add more MOD resistance tester Qty 2 to cart
Air Ministry test set Qty 1
Air Ministry test set Qty 1

Air Ministry test set Qty 1

£175.00 GBP £175.00 GBP
Air Ministryelectricalmilitarytestvintage

This product can only be purchased with a selling plan

You can't add more Air Ministry test set Qty 1 to cart
Aircraft maintenance test set Qty 1
Aircraft maintenance test set Qty 1

Aircraft maintenance test set Qty 1

£350.00 GBP £350.00 GBP
aircraftelectricalmaintenancemilitaryMODtestvintage

This product can only be purchased with a selling plan

You can't add more Aircraft maintenance test set Qty 1 to cart
Aircraft maintenance test set Qty 1
Aircraft maintenance test set Qty 1

Aircraft maintenance test set Qty 1

£290.00 GBP £290.00 GBP
aircraftelectricalmaintenancemilitaryMODtestvintage

This product can only be purchased with a selling plan

You can't add more Aircraft maintenance test set Qty 1 to cart
Frequency meter tester Qty 1
Frequency meter tester Qty 1

Frequency meter tester Qty 1

£80.00 GBP £80.00 GBP
electricalfrequencymetermilitarytestervintage

This product can only be purchased with a selling plan

You can't add more Frequency meter tester Qty 1 to cart
MOD volt meter Qty 1
MOD volt meter Qty 1

MOD volt meter Qty 1

£70.00 GBP £70.00 GBP
electricalmeterMODtestervintagevolt

This product can only be purchased with a selling plan

You can't add more MOD volt meter Qty 1 to cart
Volt meter Qty 1
Volt meter Qty 1

Volt meter Qty 1

£60.00 GBP £60.00 GBP
electricalmeterMODtestervintagevolt

This product can only be purchased with a selling plan

You can't add more Volt meter Qty 1 to cart