Military56
Column quantity
Clear all
Tropical power unit
Tropical power unit

Tropical power unit

£100.00 GBP £100.00 GBP
Airmacelectricalequipmentindustrialionisationkittesttestervintage

This product can only be purchased with a selling plan

You can't add more Tropical power unit to cart
Grey industrial vintage aluminium box
Grey industrial vintage aluminium box

Grey industrial vintage aluminium box

£240.00 GBP £240.00 GBP
1950s1960s1970s1980s1990sboxboxescrateindustrialvintage

This product can only be purchased with a selling plan

You can't add more Grey industrial vintage aluminium box to cart
Green military lead lined boxes
Green military lead lined boxes

Green military lead lined boxes

£140.00 GBP £140.00 GBP
boxboxescrateindustrialleadmilitaryvintage

This product can only be purchased with a selling plan

You can't add more Green military lead lined boxes to cart
Electrical control panel
Electrical control panel

Electrical control panel

£180.00 GBP £180.00 GBP
1920s1930s1940s1950sdecadeelectricalindustrialresistanceswitchesswitchgearvintage

This product can only be purchased with a selling plan

You can't add more Electrical control panel to cart
Survey vintage boxes

Survey vintage boxes

£60.00 GBP £60.00 GBP
1950s1960s1970s1980sboxboxesgarageindustrialmeternuclearsurveyvintage

This product can only be purchased with a selling plan

You can't add more Survey vintage boxes to cart
Military industrial storage crate
Military industrial storage crate

Military industrial storage crate

£480.00 GBP £480.00 GBP
boxcontainercrateindustrialmilitarystoragevintage

This product can only be purchased with a selling plan

You can't add more Military industrial storage crate to cart
Military industrial storage crate
Military industrial storage crate

Military industrial storage crate

£200.00 GBP £200.00 GBP
boxcontainercrateindustrialmilitarystoragevintage

This product can only be purchased with a selling plan

You can't add more Military industrial storage crate to cart
Military industrial crate round
Military industrial crate round

Military industrial crate round

£690.00 GBP £690.00 GBP
1970'sboxcontainercrateindustrialmilitaryroundstoragevintage

This product can only be purchased with a selling plan

You can't add more Military industrial crate round to cart
Military cooking station
Military cooking station

Military cooking station

£290.00 GBP £290.00 GBP
1970's1980's1990's2000's2010burnercookercookinggasindustrialmilitarystationtablevintage

This product can only be purchased with a selling plan

You can't add more Military cooking station to cart
Synchro tester

Synchro tester

£95.00 GBP £95.00 GBP
1950's1960's1970's1980'selectricalindustrialmilitarytest kittestervintage

This product can only be purchased with a selling plan

You can't add more Synchro tester to cart
Sold out
Volt meter military

Volt meter military

£10.00 GBP £10.00 GBP
electricalindustrialmetermilitarytesttestervintagevolt

This product can only be purchased with a selling plan

You can't add more Volt meter military to cart
Military weapon cases
Military weapon cases

Military weapon cases

£300.00 GBP £300.00 GBP
1940's1950'sammoboxescasescratesindustrialmilitaryvintageweapons

This product can only be purchased with a selling plan

You can't add more Military weapon cases to cart
Round fuel cans
Round fuel cans

Round fuel cans

£45.00 GBP £45.00 GBP
cansdrumsfuelgarageindustrialmilitaryoilvintage

This product can only be purchased with a selling plan

You can't add more Round fuel cans to cart
Military volted regulator

Military volted regulator

£70.00 GBP £70.00 GBP
1950's1960'sgeneratorindustrialmilitarypanelregulatorvehicle partvintagevolted

This product can only be purchased with a selling plan

You can't add more Military volted regulator to cart
US military steel pallets
US military steel pallets

US military steel pallets

£140.00 GBP £140.00 GBP
1940s1950s1960s1970sindustrialmetalmilitarypalletssteelUSvintage

This product can only be purchased with a selling plan

You can't add more US military steel pallets to cart
Mesh locker military cabinets
Mesh locker military cabinets

Mesh locker military cabinets

£490.00 GBP £490.00 GBP
cabinetindustriallockersmeshmilitaryvintage

This product can only be purchased with a selling plan

You can't add more Mesh locker military cabinets to cart
Military industrial crate
Military industrial crate

Military industrial crate

£600.00 GBP £600.00 GBP
boxcrateindustrialmilitarymissilevintageweaponweapons

This product can only be purchased with a selling plan

You can't add more Military industrial crate to cart
Military industrial crate
Military industrial crate

Military industrial crate

£800.00 GBP £800.00 GBP
1940s1950s1960s1970s1980s1990s2000s2010s2020sboxcrateindustrialmilitarymissilevintageweaponweapons

This product can only be purchased with a selling plan

You can't add more Military industrial crate to cart
Plastic military storage crates
Plastic military storage crates

Plastic military storage crates

£380.00 GBP £380.00 GBP
1970s1980s1990s2000s2010s2020scontainercrateindustrialmilitaryplasticstoragevintage

This product can only be purchased with a selling plan

You can't add more Plastic military storage crates to cart
Plastic military storage containers
Plastic military storage containers

Plastic military storage containers

£380.00 GBP £380.00 GBP
1970s1980s1990s2000s2010s2020scontainercrateindustrialmilitaryplasticstoragevintage

This product can only be purchased with a selling plan

You can't add more Plastic military storage containers to cart
Plastic black military storage containers
Plastic black military storage containers

Plastic black military storage containers

£290.00 GBP £290.00 GBP
1970s1980s1990s2000s2010s2020scontainercrateindustrialmilitaryplasticstoragevintage

This product can only be purchased with a selling plan

You can't add more Plastic black military storage containers to cart
Military industrial vintage signal box
Military industrial vintage signal box

Military industrial vintage signal box

£120.00 GBP £120.00 GBP
1970s1980s1990s2000s2010sboxboxescontainerscratecratesindustrialmilitaryvintage

This product can only be purchased with a selling plan

You can't add more Military industrial vintage signal box to cart
MOD vintage radio battery charger
MOD vintage radio battery charger

MOD vintage radio battery charger

£80.00 GBP £80.00 GBP
1950s1960s1970selectricalindustrialmilitaryMODRedifonvintage

This product can only be purchased with a selling plan

You can't add more MOD vintage radio battery charger to cart
MOD vintage fuel flow tester
MOD vintage fuel flow tester

MOD vintage fuel flow tester

£300.00 GBP £300.00 GBP
1950s1960saeronauticalelectricalflowfuelindustrialmilitaryMODtestervintage

This product can only be purchased with a selling plan

You can't add more MOD vintage fuel flow tester to cart
MOD vintage multimeter
MOD vintage multimeter

MOD vintage multimeter

£120.00 GBP £120.00 GBP
1950s1960saeronauticalaviationelectricalindustrialmilitaryMODvintage

This product can only be purchased with a selling plan

You can't add more MOD vintage multimeter to cart
Air force vintage test set
Air force vintage test set

Air force vintage test set

£290.00 GBP £290.00 GBP
1950s1960sair forceelectricalindustrialmilitarytestvintage

This product can only be purchased with a selling plan

You can't add more Air force vintage test set to cart
MOD vintage test set kit
MOD vintage test set kit

MOD vintage test set kit

£1,200.00 GBP £1,200.00 GBP
1950s1960saeronauticalelectricalindustrialkitMODtestvintage

This product can only be purchased with a selling plan

You can't add more MOD vintage test set kit to cart
MOD vintage testing set kit
MOD vintage testing set kit

MOD vintage testing set kit

£290.00 GBP £290.00 GBP
1950s1960selectricalindustrialkitmilitaryradiotesttestingvintage

This product can only be purchased with a selling plan

You can't add more MOD vintage testing set kit to cart
Radio vintage test set
Radio vintage test set

Radio vintage test set

£290.00 GBP £290.00 GBP
1950s1960sindustrialkitMODtesttestingvintage

This product can only be purchased with a selling plan

You can't add more Radio vintage test set to cart
MOD decade capacitance box
MOD decade capacitance box

MOD decade capacitance box

£140.00 GBP £140.00 GBP
boxcapacitancedecadeelectricalMODvintage

This product can only be purchased with a selling plan

You can't add more MOD decade capacitance box to cart
MOD synchro vintage test set
MOD synchro vintage test set

MOD synchro vintage test set

£150.00 GBP £150.00 GBP
electricalElliotMODsynchrotestvintage

This product can only be purchased with a selling plan

You can't add more MOD synchro vintage test set to cart
MOD general purpose test kit
MOD general purpose test kit

MOD general purpose test kit

£110.00 GBP £110.00 GBP
electricalgeneralkitmilitaryMODpurposetestvintage

This product can only be purchased with a selling plan

You can't add more MOD general purpose test kit to cart
Indicator phase sequence
Indicator phase sequence

Indicator phase sequence

£150.00 GBP £150.00 GBP
electricalindicatorMODphasescientificsequencevintage

This product can only be purchased with a selling plan

You can't add more Indicator phase sequence to cart
MOD resistance tester
MOD resistance tester

MOD resistance tester

£130.00 GBP £130.00 GBP
electricalmilitaryMODresistancescientifictestervintage

This product can only be purchased with a selling plan

You can't add more MOD resistance tester to cart
Air Ministry signal test set
Air Ministry signal test set

Air Ministry signal test set

£175.00 GBP £175.00 GBP
Air Ministryelectricalmilitarytestvintage

This product can only be purchased with a selling plan

You can't add more Air Ministry signal test set to cart
Aircraft maintenance test set
Aircraft maintenance test set

Aircraft maintenance test set

£350.00 GBP £350.00 GBP
aircraftelectricalmaintenancemilitaryMODtestvintage

This product can only be purchased with a selling plan

You can't add more Aircraft maintenance test set to cart
Aircraft maintenance test set
Aircraft maintenance test set

Aircraft maintenance test set

£290.00 GBP £290.00 GBP
aircraftelectricalmaintenancemilitaryMODtestvintage

This product can only be purchased with a selling plan

You can't add more Aircraft maintenance test set to cart
Frequency meter tester
Frequency meter tester

Frequency meter tester

£80.00 GBP £80.00 GBP
electricalfrequencymetermilitarytestervintage

This product can only be purchased with a selling plan

You can't add more Frequency meter tester to cart
MOD volt meter
MOD volt meter

MOD volt meter

£70.00 GBP £70.00 GBP
electricalmeterMODtestervintagevolt

This product can only be purchased with a selling plan

You can't add more MOD volt meter to cart
Volt meter
Volt meter

Volt meter

£60.00 GBP £60.00 GBP
electricalmeterMODtestervintagevolt

This product can only be purchased with a selling plan

You can't add more Volt meter to cart